General Information

  • ID:  hor005476
  • Uniprot ID:  P09687
  • Protein name:  Glucagon-29
  • Gene name:  gcg
  • Organism:  Scyliorhinus canicula (Small-spotted catshark) (Squalus canicula)
  • Family:  Glucagon family
  • Source:  animal
  • Expression:  Produced in the A cells of the islets of Langerhans in response to a drop in blood sugar concentration.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Scyliorhinus (genus), Scyliorhinidae (family), Carcharhiniformes (order), Galeoidea (superorder), Galeomorphii, Selachii (infraclass), Elasmobranchii (subclass), Chondrichthyes (class), Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0050896 response to stimulus
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  HSEGTFTSDYSKYMDNRRAKDFVQWLMST
  • Length:  29
  • Propeptide:  HSEGTFTSDYSKYMDNRRAKDFVQWLMSTKRNGHAEGTYTSDVDSLSDYFKAKRFVDSLKSY
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Promotes hydrolysis of glycogen and lipids, and raises the blood sugar level.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P09687-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor005476_AF2.pdbhor005476_ESM.pdb

Physical Information

Mass: 400144 Formula: C153H226N42O49S2
Absent amino acids: CIP Common amino acids: S
pI: 7.53 Basic residues: 5
Polar residues: 11 Hydrophobic residues: 6
Hydrophobicity: -106.9 Boman Index: -8764
Half-Life: 3.5 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 26.9
Instability Index: 6933.45 Extinction Coefficient cystines: 8480
Absorbance 280nm: 302.86

Literature

  • PubMed ID:  3569517
  • Title:  Primary structure of glucagon from the gut of the common dogfish (Scyliorhinus canicula).